DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and faim2

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001072357.1 Gene:faim2 / 779810 XenbaseID:XB-GENE-953203 Length:311 Species:Xenopus tropicalis


Alignment Length:281 Identity:110/281 - (39%)
Similarity:165/281 - (58%) Gaps:10/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PQGYPPYAQGGAQPYPQPYGQGPPPGGYAPQPG--FIQPPPSAGGYGAYDDPESQPKNFSFDDQS 108
            |..|.....|..:.........|....::.|.|  :..|..|:|.|..  |.|..... |:|:::
 Frog    32 PPSYEEATAGDGKKADYLQATSPTLSQHSWQHGEPYNSPDCSSGIYSG--DTEMLTTQ-SWDNET 93

  Fly   109 IRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVR 173
            :|||||||||.|||.||:||...||||.:.:..|.:.:.|...:|.:..|...|.|.:|||...|
 Frog    94 VRRGFIRKVYAILMIQLLVTVAVVALFTFCDPVKGYIQANPGWYWASYAVFFSTYLVLACCSGPR 158

  Fly   174 RQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGIL 238
            |:.|.|.|.|.:||.:.:::.|:.::.|..|.|::.:||||.||:::|:|:.|:|.|||...|:|
 Frog   159 RKFPWNLILLCIFTLSMAYITGMLSSFYNTKSVILCLGITALVCMSVTLFSFQSKIDFTSCQGVL 223

  Fly   239 IACMVVFLIFGI-VAIFVKGKIIT---LVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIF 299
            ....:|.|..|| :.|.:..:.|.   .|||.|||::|:::|.:|||::| |..:||:|||||||
 Frog   224 FVLSMVLLFSGIFLVILIPFQYIPWLHAVYAVIGAIVFTMFLAFDTQMLM-GSRRYSLSPEEYIF 287

  Fly   300 AALNLYLDIINIFMYILTIIG 320
            .|||:|||||.||.::|.:.|
 Frog   288 GALNIYLDIIYIFSFLLQLFG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 97/220 (44%)
faim2NP_001072357.1 LFG_like 88..308 CDD:198410 97/220 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - otm47433
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.