DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and CG34430

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster


Alignment Length:224 Identity:61/224 - (27%)
Similarity:109/224 - (48%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KNFSFD--DQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVT 162
            :.:.||  |..|||..:|:.|.||:.|:..|...:.||:.:.....|          .:.:.:|.
  Fly    30 RTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNF----------VMPLSMVF 84

  Fly   163 MLSMACCESV----RRQTPTNFIFLGLFTAAQSF-----LMGVSATKYA---PKEVLMAVGITAA 215
            .:.:..|..|    ||..|.|:..|.|.|...||     |:.:..|.:.   |  |::.:.|   
  Fly    85 TVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYP--VILIIEI--- 144

  Fly   216 VCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFV-KGKIITLVYASIGALLFSVYLIYD 279
              |.|.:::.|.::.||.:.||    .::.||||:..:.. :...:..|::::...:.:.|:|||
  Fly   145 --LGLMLYSSQKRFRFTQIRGI----SIISLIFGLFLLLAYRLNRMMEVFSAMACTVEAWYIIYD 203

  Fly   280 TQLMMGGEHKYSISPEEYIFAALNLYLDI 308
            |..|:.|.|.|:|.|||:::||.|::.|:
  Fly   204 THYMLCGRHGYNIGPEEFVYAACNIHCDL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 61/221 (28%)
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.