DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and LOC566927

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_017213252.1 Gene:LOC566927 / 566927 -ID:- Length:236 Species:Danio rerio


Alignment Length:254 Identity:96/254 - (37%)
Similarity:129/254 - (50%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQSVPQYPQYQDPNQQYNYGGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQPYG 65
            ||....|  |.|::..|| :||   |.|.|...|||. |:|.|  |..|....|.|..|.|..: 
Zfish     1 MSKSDPP--PSYEESRQQ-SYG---PQQHGTYPYPPY-GFPAQ--PGVYTGPGQAGIHPQPGLW- 55

  Fly    66 QGPPPGGY------APQPGFIQPPPSAGGYGAYD----DPESQPKNFSFDDQSIRRGFIRKVYLI 120
            |||   ||      :..|.||.|       |.:.    |.|.......::..|:|..||||||||
Zfish    56 QGP---GYPSTAMPSMMPSFIAP-------GIFSSNLRDAEDVSSTGVWESMSVRHAFIRKVYLI 110

  Fly   121 LMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGL 185
            |..||.:|...:|:|.:.|..:.|...|..|:|.:..:.|||.|.:.|||..||:.|.|.|.|.:
Zfish   111 LAAQLFITSSIIAVFAFVEPVRLFVIQNPALYWASFPIYLVTYLMLVCCEGPRRRHPWNLILLFI 175

  Fly   186 FTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVV 244
            ||...|::.|..::.:..|.|.:|:||||.||:.:|:|:.|||.|||...|:|.|..||
Zfish   176 FTLTLSYMTGTISSYFDTKAVFLALGITAIVCVIVTVFSFQTKVDFTSCTGLLCALCVV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 60/142 (42%)
LOC566927XP_017213252.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.