DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and TMBIM4

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001269535.1 Gene:TMBIM4 / 51643 HGNCID:24257 Length:285 Species:Homo sapiens


Alignment Length:229 Identity:80/229 - (34%)
Similarity:123/229 - (53%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QSIRRG----------FIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWV----ALG 157
            ||.|.|          |:||||.||..|:::|.....:|:|.|..:||...:..|..:    :||
Human    65 QSGRSGMVNIFYKGPTFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLG 129

  Fly   158 VMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTI 222
            ::...:|:       |.:.|.|...|..||..::..:.|..|.|....:|.|..:|..|...||:
Human   130 LIFALILN-------RHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTV 187

  Fly   223 FALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGE 287
            :.||:|.||:..|..|.|.:.:..:.|.:..|...:|:.||.|:.|||||..::||||..:|   
Human   188 YTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLM--- 249

  Fly   288 HKYSISPEEYIFAALNLYLDIINIFMYILTIIGA 321
            ||  :|||||:.||::|||||||:|:::|..:.|
Human   250 HK--LSPEEYVLAAISLYLDIINLFLHLLRFLEA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 79/226 (35%)
TMBIM4NP_001269535.1 GAAP_like 6..283 CDD:198411 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.