DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and BI-1

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:93/237 - (39%) Gaps:64/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RGFIRKVYLIL--------MGQLI-----VTFGAVAL-----------FVYHEGTKTFARNNM-W 150
            |..:.|||::|        ||.::     :..|.:|.           |...:|...:.|..| :
  Fly    28 REHLSKVYMVLGSTAAATAMGAMLQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLY 92

  Fly   151 LFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAA 215
            .|....|..|..:|...|  |:.                             |..:|.|:..|..
  Fly    93 AFGFCSGQTLGPLLGYIC--SIN-----------------------------PAIILSALTGTFV 126

  Fly   216 VCLALTIFAL---QTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLI 277
            ..::|::.||   |.||.:  :||:|::.:....:..:..:..|...:.:....:|..:.:.:::
  Fly   127 TFISLSLSALLAEQGKYLY--LGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIV 189

  Fly   278 YDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTII 319
            ||||.::   .|......:.:..||:|:.|::::|..:|.|:
  Fly   190 YDTQNIV---EKCRNGNRDVVQHALDLFFDVLSMFRRLLIIL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 46/237 (19%)
BI-1NP_648205.1 BI-1 21..233 CDD:198412 46/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.