DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and Tmbim4

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_954547.1 Gene:Tmbim4 / 362884 RGDID:735173 Length:238 Species:Rattus norvegicus


Alignment Length:215 Identity:85/215 - (39%)
Similarity:126/215 - (58%) Gaps:12/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 IRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWV-ALGVM-LVTMLSMACCES 171
            ||..|:||||.||..|:::|....|||:|.|..:||..::..|..| |||.: |:..|::.    
  Rat    30 IRMAFLRKVYSILSLQVLLTTVTSALFLYFETLRTFVHDSPALIVVFALGSLGLIFALTLH---- 90

  Fly   172 VRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGG 236
             |...|.|...|..||.:::..:....|.|....||.|..:||||.|.||.:.||:|.||:..|.
  Rat    91 -RHTHPLNLYLLFAFTLSEALTVATVVTFYDGHLVLHAFILTAAVFLGLTAYTLQSKRDFSKFGA 154

  Fly   237 ILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAA 301
            .|.||:.:..:.|.:.:|...:.:.||.||:|||||..::||||..:|     :.:|||||:.||
  Rat   155 GLFACLWILCLAGFLKVFFYSQTVELVLASLGALLFCGFIIYDTHSLM-----HRLSPEEYVLAA 214

  Fly   302 LNLYLDIINIFMYILTIIGA 321
            ::|||||||:|:::|..:.|
  Rat   215 ISLYLDIINLFLHLLKFLDA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 84/212 (40%)
Tmbim4NP_954547.1 GAAP_like 6..236 CDD:198411 85/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.