DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and Tmbim1

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 / 316516 RGDID:1359409 Length:309 Species:Rattus norvegicus


Alignment Length:336 Identity:129/336 - (38%)
Similarity:187/336 - (55%) Gaps:39/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQSVPQYPQYQDPNQQYNYGGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQP-Y 64
            ||..:.|  |.|:|.|..|   .|.||.||||        .|...|.|||.|     ..|||| |
  Rat     1 MSNPTAP--PPYEDHNPLY---PGRPPPGGYG--------QPSVLPGGYPAY-----PAYPQPGY 47

  Fly    65 GQGPPPGGYAPQPGFIQPP--PSAGGYGAYDDPESQPKNFSF-----DDQSIRRGFIRKVYLILM 122
            |.   |.|| |||   .||  |....||.....|.:..:.||     ||:.:|..||:|||.|:.
  Rat    48 GH---PAGY-PQP---IPPVHPMPMNYGHDYSEEERAGSDSFGPGEWDDRKVRHTFIQKVYCIIS 105

  Fly   123 GQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFT 187
            .||::|...:|:|.:.|....:.|:|:.:::|:..|.:||.|.:.||:..||:.|.|.|.|.:||
  Rat   106 VQLLITVAIIAVFTFVEPVSEYVRSNVAVYYVSYAVFIVTYLILVCCQGPRRRFPWNIILLTIFT 170

  Fly   188 AAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFG--- 249
            .|..|:.|..::.|..|.|::|:.|||.|.:::|||..|||.|||...|::....:|..:.|   
  Rat   171 LALGFMTGAISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVTGAVT 235

  Fly   250 -IVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFM 313
             :|..|.....:.:|||.:||:.|:::|.|||||:: |..|::||||:||..||.:|.||:.||.
  Rat   236 SVVLFFEYIYWLHMVYAGLGAICFTLFLAYDTQLVL-GNRKHTISPEDYITGALQIYTDIVYIFT 299

  Fly   314 YILTIIGASRD 324
            ::|.::| :||
  Rat   300 FVLQLVG-NRD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 87/225 (39%)
Tmbim1NP_001007714.1 LFG_like 87..306 CDD:198410 85/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.