DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and Grina

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_695220.4 Gene:Grina / 266668 RGDID:628873 Length:348 Species:Rattus norvegicus


Alignment Length:329 Identity:150/329 - (45%)
Similarity:210/329 - (63%) Gaps:35/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YPQ-------YQDPNQQYNYGGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPY-PQPYG 65
            |||       |..|.  |.:|.|..|||||    |||.||..|.|||  ||.|   .|: |.|||
  Rat    42 YPQAAFQPSPYGQPG--YPHGPGPYPQGGY----PQGPYPQGGYPQG--PYPQ---SPFPPNPYG 95

  Fly    66 QGPP---PGGYAPQPGFIQP--PPSAGGYGAYDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQL 125
            |.||   ||  :||.|..|.  |||     .||:.:....|:   |:|||:.|||||:|:|..||
  Rat    96 QPPPFQDPG--SPQHGNYQEEGPPS-----YYDNQDFPSVNW---DKSIRQAFIRKVFLVLTLQL 150

  Fly   126 IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQ 190
            .||...||:|.:....|.|.|.|:|.::|:..:..::::.::||...||:.|.|.:.|.:.|.:.
  Rat   151 SVTLSTVAIFTFVGEVKGFVRANVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTISL 215

  Fly   191 SFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFV 255
            |:::|:.|:.|..:.|:||||||.|||..:.||::||:||||...|:|:..:||..||.|:.||:
  Rat   216 SYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFI 280

  Fly   256 KGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIG 320
            :.:|:.:||||:|||||:.:|..||||::|.: :.|:|||||:|||||||.||||||:|||||||
  Rat   281 RNRILEIVYASLGALLFTCFLAVDTQLLLGNK-QLSLSPEEYVFAALNLYTDIINIFLYILTIIG 344

  Fly   321 ASRD 324
            .:::
  Rat   345 RAKE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 103/216 (48%)
GrinaNP_695220.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 40/88 (45%)
Pro-rich <16..126 CDD:291893 44/101 (44%)
Bindin 24..>105 CDD:251078 35/75 (47%)
LFG_like 131..344 CDD:198410 103/213 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2719
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41517
Inparanoid 1 1.050 264 1.000 Inparanoid score I2996
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8911
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.