DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and bxi1

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_588431.1 Gene:bxi1 / 2539556 PomBaseID:SPCC576.04 Length:266 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:93/276 - (33%)
Similarity:142/276 - (51%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PGGY--APQ-----PGFIQPPPSAGGYGAYDDPESQPKNFSFDD-----------QSIRRGFIRK 116
            |..|  .||     |...|.||:   |..|:  ||..:|.:.|.           :|||..|:||
pombe     2 PANYQSVPQDDPSVPNLAQAPPA---YSEYN--ESATENPAVDQFKNTTPVAECAKSIRMAFLRK 61

  Fly   117 VYLILMGQLIVT--FGAVALFVYHEGTKTFARNNMWL----FWVALGVMLVTMLSMACCESVRRQ 175
            ||.||..||.||  ||.:  |..|.....:.:.:.|.    |:::|.|:...::.       ...
pombe    62 VYAILTAQLFVTSLFGGI--FYLHPAFSFWVQMHPWFLILNFFISLVVLFGLIMK-------PYS 117

  Fly   176 TPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIA 240
            .|.|:|||.||||.:...:|.:.|.::.:.:|.||.||..|.:|||.|..|:|:||:.:||.|..
pombe   118 YPRNYIFLFLFTALEGLTLGTAITFFSARIILEAVFITLGVFVALTAFTFQSKWDFSRLGGFLYV 182

  Fly   241 CMVVFLIFGIVAIFVKG-KIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNL 304
            .:...::..::..||.. ..|.:.:|..|.|:|..|:::||..::   |:|  ||||:|.::|.|
pombe   183 SLWSLILTPLIFFFVPSTPFIDMAFAGFGTLVFCGYILFDTYNIL---HRY--SPEEFIMSSLML 242

  Fly   305 YLDIINIFMYILTIIG 320
            |||.||:|:.||.|:|
pombe   243 YLDFINLFIRILQILG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 79/234 (34%)
bxi1NP_588431.1 GAAP_like 29..261 CDD:198411 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1325
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1363
OMA 1 1.010 - - QHG57711
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - otm46971
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.