DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and Faim2

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_653357.1 Gene:Faim2 / 246274 RGDID:628744 Length:316 Species:Rattus norvegicus


Alignment Length:295 Identity:116/295 - (39%)
Similarity:170/295 - (57%) Gaps:22/295 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PQGPPQGYPPYAQG-----GAQPYPQPYGQGPPPGGYAPQPGFIQPPPSAGGYGAYDDPESQPK- 100
            |..|| .|.....|     ||.|      |||......|...::.|..|:|..|.:  |....: 
  Rat    32 PSAPP-SYEEATSGEGLKAGAFP------QGPTAVPLHPSWAYVDPSSSSGYEGGF--PAGHHEL 87

  Fly   101 --NFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTM 163
              .||:|||.:|:.||||||.||:.||:||...||||.:.:..|.:.:.|...:|.:..|...|.
  Rat    88 FSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATY 152

  Fly   164 LSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTK 228
            |::|||...||..|.|.|.|.:||.:.::|.|:.::.|....||:.:||||.|||::|||:.|||
  Rat   153 LTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTK 217

  Fly   229 YDFTMMGGILIACMVVFLIFG-IVAIFVKGKIIT---LVYASIGALLFSVYLIYDTQLMMGGEHK 289
            :|||...|:|...::.....| ::||.:..:.:.   .|||.:||.:|:::|.:||||:| |..:
  Rat   218 FDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLM-GNRR 281

  Fly   290 YSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 324
            :|:|||||||.|||:|||||.||.:.|.:.|.:|:
  Rat   282 HSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 96/220 (44%)
Faim2NP_653357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 5/17 (29%)
LFG_like 92..312 CDD:198410 96/220 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2719
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8911
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.