DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and tmbi-4

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_509543.2 Gene:tmbi-4 / 181150 WormBaseID:WBGene00006479 Length:276 Species:Caenorhabditis elegans


Alignment Length:220 Identity:74/220 - (33%)
Similarity:110/220 - (50%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVAL--GVMLVTMLSMAC 168
            ::.||..|:|||..|:..||:.|.|..|.......:....:.:.|:.:..|  .:.|:..|.:  
 Worm    66 NRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQKHAWIVFPNLLGSIALIIALHV-- 128

  Fly   169 CESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTM 233
               ..|:.|.|::.|..|||.|:..||...|.:..|.||.|..||..|..:|..:.||.|.||::
 Worm   129 ---YAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAYTLQNKRDFSV 190

  Fly   234 ----MGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISP 294
                ||.:|  |  |.|..||..:|.....:..|....||.||.|.|:.|..::|     |..||
 Worm   191 GYASMGSLL--C--VLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMIM-----YRFSP 246

  Fly   295 EEYIFAALNLYLDIINIFMYILTII 319
            |:||.|.::||:||:|:|:.||.|:
 Worm   247 EDYICACVSLYMDILNLFIRILQIV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 74/220 (34%)
tmbi-4NP_509543.2 GAAP_like 43..275 CDD:198411 74/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.