DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and grina

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001120085.1 Gene:grina / 100145094 XenbaseID:XB-GENE-5740104 Length:286 Species:Xenopus tropicalis


Alignment Length:281 Identity:114/281 - (40%)
Similarity:166/281 - (59%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GGYAPQPGFIQPPPS-----------------------AGGYGAYDDPESQPKNFS--------F 104
            ||....|.::.||||                       |..|..: |.|:.|..::        |
 Frog     2 GGGPSVPVYMPPPPSYSEQDPAALNAQINNPSSQIFLEANSYPEH-DAEAGPPEYTFGVVGSSPF 65

  Fly   105 DDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACC 169
            .:.:|||.|||||||.|..||.:|.|.:.:|::.:..|.:.:...::.:.....:::..|.:|||
 Frog    66 SESAIRRAFIRKVYLTLAMQLALTVGLICMFIFWKRLKNWVQEYPYIVYALCPAIIILALVLACC 130

  Fly   170 ESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMM 234
            :.|||:.|.||||||||||.:..::|..|..:....|:.|.|.|..|.|.|||||||||:||||:
 Frog   131 QQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTKWDFTML 195

  Fly   235 GGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIF 299
            .|.|...::|.|.|||:...::...:.:||||||..:|.:||:.||||::||:|:|::|||||||
 Frog   196 SGGLCVALLVLLCFGILCGILRSMYLNIVYASIGTFIFGMYLVVDTQLIVGGKHRYAVSPEEYIF 260

  Fly   300 AALNLYLDIINIFMYILTIIG 320
            ||||:||||||:|:.:|.|.|
 Frog   261 AALNIYLDIINLFLMLLQIFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 101/224 (45%)
grinaNP_001120085.1 DUF4526 <4..>55 CDD:291688 10/51 (20%)
LFG_like 64..281 CDD:198410 101/216 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2553
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - otm47433
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.