DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and faim2b

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001373641.1 Gene:faim2b / 100006044 ZFINID:ZDB-GENE-120426-3 Length:263 Species:Danio rerio


Alignment Length:253 Identity:107/253 - (42%)
Similarity:161/253 - (63%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PPS-----AG--GYGAYDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEG 140
            |||     ||  || .|.|     ..|::||.|:||.||||||.|||.||..|...:|||.:|..
Zfish    18 PPSYEEANAGCPGY-YYGD-----GGFTWDDASVRRIFIRKVYSILMLQLFSTVAVIALFTFHAP 76

  Fly   141 TKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKE 205
            .:.:.:.:..|:..:..:.|:|.:|:|||..:|||.|.|.|.|.:||.:.:.::|..::.|..|.
Zfish    77 VRMYIQTHPILYSASNLLFLITYISLACCGDLRRQFPWNLILLTVFTLSMACMLGFISSFYNTKA 141

  Fly   206 VLMAVGITAAVCLALTIFALQTKYDFTMMGGIL-IACMVVF---LIFGIVAIFVKGKIITLVYAS 266
            |::.:||||.|||.:|:|:.|:|.|.|...|:| |.|||:|   ::.|.|..|.....:..||:|
Zfish   142 VVLCIGITAVVCLCVTLFSFQSKIDITSYQGLLFILCMVMFFCAIVMGFVVPFGYVPWLHAVYSS 206

  Fly   267 IGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 324
            |||::|:::|.:||||:||.: :|::|||||:||.|:|||||:.:|.::|.:.|..||
Zfish   207 IGAVVFTMFLAFDTQLLMGNK-QYTLSPEEYVFATLSLYLDIVYLFTFLLQMFGQGRD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 94/220 (43%)
faim2bNP_001373641.1 LFG_like 39..259 CDD:198410 94/220 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.