DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and AT4G14730

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_193209.2 Gene:AT4G14730 / 827126 AraportID:AT4G14730 Length:235 Species:Arabidopsis thaliana


Alignment Length:222 Identity:67/222 - (30%)
Similarity:131/222 - (59%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWV---QKNPALFWIALAVLIVTMICM 86
            :...:|..||||:|.||..|||:|.|..:|..|.:...|::   .:..|:|::   :|::.::.:
plant    20 ESSELRWAFIRKLYSILSLQLLVTVGVSAVVYFVRPIPEFITETHRGLAVFFV---ILLLPLLLL 81

  Fly    87 ACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLF---ALQTK 148
            ....:..:|.|:|.|.|.:||::.||.:|:.....:...||.|..:||.:..|||::   |::..
plant    82 WPLLAFEKKHPINCIVLSIFTLSISFSVGICCSLSQGRIVLEAAILTAVMVFGLTIYTFWAVKRG 146

  Fly   149 YDFTMCGGVLVACLVVFIIFGIIAIFIP-GKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSI 212
            :||:..|..|...|::.::|.::.||.| ||:..::::.:.:::|..|:::||..::     ..:
plant   147 HDFSFLGPFLFGALLIILVFTLLQIFHPLGKLSSMIFSGIASIVFCGYIIFDTNQLI-----KKL 206

  Fly   213 SPEEYIFAALNLYLDIINIFMYILTII 239
            :.:|||.||:.||||::|:|:.:|.||
plant   207 NYDEYITAAIRLYLDVMNLFLSLLGII 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 67/222 (30%)
AT4G14730NP_193209.2 BI-1-like 9..235 CDD:320991 67/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1887
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm996
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.