DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and BIL4

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_191890.1 Gene:BIL4 / 825506 AraportID:AT3G63310 Length:239 Species:Arabidopsis thaliana


Alignment Length:219 Identity:70/219 - (31%)
Similarity:121/219 - (55%) Gaps:9/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACC 89
            :...:|..||||||.|:..|||:|....:......:...:.....|.|.:.:.:::..:|.|...
plant    21 ESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTTTTAGFALYILLILTPLIVMCPL 85

  Fly    90 ESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLF---ALQTKYDF 151
            ....:|.|:|::.|.:||||.:|.:|:.........:|.:|.:||.|.:.|||:   |.:..:||
plant    86 YYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVILESVILTAVVVISLTLYTFWAAKRGHDF 150

  Fly   152 TMCGGVLVACLVVFIIFGIIAIFIP-GKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPE 215
            ...|..|...::|.::|..|.|..| ||:..::|..|.:::|..|:||||..:: ..|.|    :
plant   151 NFLGPFLFGAVIVLMVFSFIQILFPLGKISVMIYGCLASIIFCGYIVYDTDNLI-KRHSY----D 210

  Fly   216 EYIFAALNLYLDIINIFMYILTII 239
            |||:||::||||:||:|:.:||::
plant   211 EYIWAAVSLYLDVINLFLSLLTLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 70/219 (32%)
BIL4NP_191890.1 BI-1-like 22..225 CDD:320991 65/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1887
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm996
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.