DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and Faim2

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_082500.2 Gene:Faim2 / 72393 MGIID:1919643 Length:317 Species:Mus musculus


Alignment Length:244 Identity:105/244 - (43%)
Similarity:158/244 - (64%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKN 68
            |:.|...|.:   |...:|::|||.:|:.||||||.||:.|||:|...|::|||....:::||.|
Mouse    77 YEGGFPAGHH---EHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQAN 138

  Fly    69 PALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGIT 133
            |..:|.:.||...|.:.:|||...||..|.|.|.|.:||::.::|.||::..:....||:.:.||
Mouse   139 PGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVIT 203

  Fly   134 AAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFG-IIAIFIPGKVI---GLVYASLGALLFSV 194
            |.|.|.:|:|:.|||:|||.|.|||...|:.....| ::|:.:|.:.:   ..|||.|||.:|::
Mouse   204 ALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTL 268

  Fly   195 YLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSR 243
            :|.:||||:: ||.::|:|||||||.|||:|||||.||.:.|.:.|.:|
Mouse   269 FLAFDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 98/220 (45%)
Faim2NP_082500.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
LFG_like 93..313 CDD:198410 98/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8676
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.