DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and CG34430

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:109/220 - (49%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KSFAFD--DQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVT 82
            :::.||  |..||:..:|:.|.||:.|:..|...:.:|.          |.|..:...:.:.:|.
  Fly    30 RTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELFL----------KYPLPYNFVMPLSMVF 84

  Fly    83 MICMACCESV----RRKTPLNFIFLFLFTVAESF-----LLGMVAGQFEADEVLMAVGITAAVAL 138
            .:.:..|..|    ||..|.|:..|.|.|:..||     ||.:|    |...|.:...|.....|
  Fly    85 TVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLV----ETHWVYIYPVILIIEIL 145

  Fly   139 GLTLFALQTKYDFTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLM 203
            ||.|::.|.::.||...|:.:..| :|.:|.::|..:...:  .|::::...:.:.|::|||..|
  Fly   146 GLMLYSSQKRFRFTQIRGISIISL-IFGLFLLLAYRLNRMM--EVFSAMACTVEAWYIIYDTHYM 207

  Fly   204 LGGNHKYSISPEEYIFAALNLYLDI 228
            |.|.|.|:|.|||:::||.|::.|:
  Fly   208 LCGRHGYNIGPEEFVYAACNIHCDL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 62/217 (29%)
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 58/206 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.