DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and LOC566927

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_017213252.1 Gene:LOC566927 / 566927 -ID:- Length:236 Species:Danio rerio


Alignment Length:151 Identity:65/151 - (43%)
Similarity:96/151 - (63%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DAE-ADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAV 78
            ||| ...:..::..|:|..|||||||||..||.||...::||.|.:..:.:|.:||||:|.:..:
Zfish    84 DAEDVSSTGVWESMSVRHAFIRKVYLILAAQLFITSSIIAVFAFVEPVRLFVIQNPALYWASFPI 148

  Fly    79 LIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLF 143
            .:||.:.:.|||..||:.|.|.|.||:||:..|::.|.::..|:...|.:|:||||.|.:.:|:|
Zfish   149 YLVTYLMLVCCEGPRRRHPWNLILLFIFTLTLSYMTGTISSYFDTKAVFLALGITAIVCVIVTVF 213

  Fly   144 ALQTKYDFTMCGGVLVACLVV 164
            :.|||.|||.|.|:|.|..||
Zfish   214 SFQTKVDFTSCTGLLCALCVV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 62/142 (44%)
LOC566927XP_017213252.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.