DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and zgc:110410

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001315301.1 Gene:zgc:110410 / 553618 ZFINID:ZDB-GENE-050522-465 Length:405 Species:Danio rerio


Alignment Length:223 Identity:114/223 - (51%)
Similarity:150/223 - (67%) Gaps:6/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVT---MIC 85
            |.|.:||:||||||||.||.|||||.|.:..|.:.:...:||:..   :|....::.||   :|.
Zfish   186 FSDAAIRRGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDT---YWFTYTMMGVTFALVIV 247

  Fly    86 MACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYD 150
            :.||..:|||.|||||||.|||:||..|||.|...:.|:.||.|||.||.|:|.::||:||:|:|
Zfish   248 LVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWD 312

  Fly   151 FTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPE 215
            ||...|.:.|.......|.::...:..:.:.:.|||||.|:||||||.||||:|||.||||||||
Zfish   313 FTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPE 377

  Fly   216 EYIFAALNLYLDIINIFMYILTIIGLSR 243
            ||||||||||:||:.||:.:|.:||..|
Zfish   378 EYIFAALNLYIDIVTIFLLLLQLIGFCR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 111/218 (51%)
zgc:110410NP_001315301.1 Bindin 89..>171 CDD:251078
LFG_like 186..402 CDD:198410 111/218 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - otm25342
orthoMCL 1 0.900 - - OOG6_100360
Panther 1 1.100 - - LDO PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.