DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and tmbim1a

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001005992.2 Gene:tmbim1a / 449819 ZFINID:ZDB-GENE-041010-69 Length:332 Species:Danio rerio


Alignment Length:238 Identity:106/238 - (44%)
Similarity:154/238 - (64%) Gaps:11/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPAL 71
            ||..| :|.||     .|:...:|..|||||||||..|||:|...|::|||.:....:|:||||:
Zfish    98 GDSEG-FTTAE-----GFESTDVRHSFIRKVYLILAAQLLVTAAVVAIFTFVEPVGLFVRKNPAI 156

  Fly    72 FWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAV 136
            :|::.|:..||.|.:.||:..||:.|.|.:.|.:||:|.||:.|.:|..:....|.:|:.||..|
Zfish   157 YWVSYAIYFVTHIVLVCCQGPRRRFPWNLLLLAIFTLALSFMTGNIASYYSTRAVFLALAITVVV 221

  Fly   137 ALGLTLFALQTKYDFTMCGGVLVACLVVFIIFGII-AIFIPGKVI---GLVYASLGALLFSVYLV 197
            .:.:|:|..|||.|||.|.|......:|..:.||| ||.:..|.:   .::|||:||:.|:::|.
Zfish   222 CVAVTVFCFQTKVDFTKCSGFFCVLGIVVFVTGIITAIVLSFKYVPWLHMLYASIGAIAFTLFLA 286

  Fly   198 YDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIG 240
            |.|||:: ||.|.|||||||:||||:||:||:.||:::|.|||
Zfish   287 YHTQLLI-GNRKLSISPEEYVFAALSLYVDIVQIFIFLLQIIG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 98/220 (45%)
tmbim1aNP_001005992.2 ARS2 <21..83 CDD:282772
LFG_like 108..328 CDD:198410 98/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.