DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and tmbim4

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001004879.1 Gene:tmbim4 / 448209 XenbaseID:XB-GENE-947555 Length:235 Species:Xenopus tropicalis


Alignment Length:211 Identity:79/211 - (37%)
Similarity:126/211 - (59%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACCESVR 93
            ||..|::|||.||..|:|:|....::|.:||:.|.:|.::|||..|::...:.|:|.:..   .|
 Frog    27 IRMDFLKKVYSILTTQILLTTLTAALFLYSKSIQTFVHESPALLLISVIGSLGTVIALTI---YR 88

  Fly    94 RKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVL 158
            ::.|:|...|..||..|:..:......::...||.|..:|.||.||||.|..|:|.||:..|..|
 Frog    89 QQHPVNLYLLLAFTAFEAVTVATAVTFYDVAVVLQAFILTTAVFLGLTAFTFQSKRDFSKFGAGL 153

  Fly   159 VACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPEEYIFAALN 223
            ...|.:.|....:.:|...:.:.|:.|:.|||||..::::||.|::   ||  :||||||.|::|
 Frog   154 FTGLWILIFASFLRLFFYSETVELLIAAAGALLFCGFIIFDTHLLM---HK--LSPEEYILASVN 213

  Fly   224 LYLDIINIFMYILTII 239
            |||||||:|:::|.|:
 Frog   214 LYLDIINLFLHLLRIL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 79/211 (37%)
tmbim4NP_001004879.1 GAAP_like 2..233 CDD:198411 79/211 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.