DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and Mics1

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster


Alignment Length:248 Identity:59/248 - (23%)
Similarity:94/248 - (37%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GAYTDAEADKSFAFDDQS------IRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNP 69
            ||.....|..:.||....      .|.|::..         |:|.|.|.:   |.:..:.::..|
  Fly   152 GASCGVTAASAVAFFQSDAMMALMTRSGWVAS---------LVTLGLVML---SGSIAQGLEYQP 204

  Fly    70 A-----LFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMA 129
            .     |.|:....::..::...|                        |||   |......:|..
  Fly   205 GFGAKQLAWLVHCAVLGAVLAPMC------------------------LLG---GPILTKALLYT 242

  Fly   130 VGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFGIIAIFIPGKV---IGLVYASL--GA 189
            .||..|::   |:.|......|...||.|...|.|.....:.::::|...   .||...||  |.
  Fly   243 SGIVGALS---TVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSLYGGL 304

  Fly   190 LLFSVYLVYDTQLMLGGNH---KYSISPEEYIFAALNLYLDIINIFMYILTII 239
            :|||.:|:||||.::....   :||..|.:.|..||.:|:|.:|||:.|..|:
  Fly   305 ILFSGFLLYDTQRIVKSAELYPQYSKFPYDPINHALAIYMDALNIFIRIAIIL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 56/236 (24%)
Mics1NP_649725.2 GHITM 116..364 CDD:198413 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.