DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and tmbim4

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_998303.2 Gene:tmbim4 / 406412 ZFINID:ZDB-GENE-040426-2152 Length:236 Species:Danio rerio


Alignment Length:211 Identity:79/211 - (37%)
Similarity:124/211 - (58%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACCESVR 93
            ||..|:||||.||..|::||....::|......:.:|.::|:|..|:....::.::.:|   ..|
Zfish    28 IRMDFLRKVYTILSLQIIITTAVSALFMLCNPIKNFVHESPSLVLISAIGSLILLLALA---FYR 89

  Fly    94 RKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVL 158
            .:.|:|...||.||:.||..:......:|...||.|..:|:||.||||.:..|:|.||:..|..|
Zfish    90 HQHPVNLYLLFGFTLLESLSVATAVSFYEYTIVLQAFVLTSAVFLGLTAYTFQSKRDFSKLGASL 154

  Fly   159 VACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPEEYIFAALN 223
            .|.|.:.||...:..|.....:.||:|..|||||..::::||.|::   ||  :||||::.|::|
Zfish   155 FAGLWILIIASFLRFFFYNDTMELVFAGAGALLFCGFIIFDTHLLM---HK--LSPEEHVLASIN 214

  Fly   224 LYLDIINIFMYILTII 239
            |||||:|:|:|||.|:
Zfish   215 LYLDIVNLFLYILRIL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 79/211 (37%)
tmbim4NP_998303.2 GAAP_like 4..233 CDD:198411 79/211 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.