DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and grinab

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001295540.1 Gene:grinab / 394183 ZFINID:ZDB-GENE-040426-1367 Length:337 Species:Danio rerio


Alignment Length:239 Identity:108/239 - (45%)
Similarity:159/239 - (66%) Gaps:2/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPA 70
            |.::...| |::...|...|::.||:.|||||:.:|..||.||..||::|||....:.:|.:|..
Zfish   101 QSNDPPEY-DSDQFTSSGLDNKEIRRVFIRKVFSVLSLQLAITTAFVAIFTFEPHVKLFVMQNSW 164

  Fly    71 LFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAA 135
            .:|:...|.:|....:.||...|||.|.|.|.|.:.|:|.|:::|:::..::.|.|:||:|||..
Zfish   165 TYWVGYLVFLVPYFVILCCGEFRRKHPWNLICLSVLTLAMSYMVGVISSFYDTDIVIMAIGITVV 229

  Fly   136 VALGLTLFALQTKYDFTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDT 200
            |...:.:|::|||||||.|.|||..|.:|..:|||:.|....|::.|:|::||||||:.:|..||
Zfish   230 VCFTVIIFSMQTKYDFTSCYGVLFVCGIVLFVFGILCIIFYSKIMDLIYSTLGALLFTCFLAVDT 294

  Fly   201 QLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSRN 244
            ||:| ||...|:||||||||:||||||||.||::||.|:|.||:
Zfish   295 QLLL-GNKNLSLSPEEYIFASLNLYLDIIQIFLFILRILGRSRS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 101/216 (47%)
grinabNP_001295540.1 LFG_like 119..333 CDD:198410 101/214 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2436
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 268 1.000 Inparanoid score I3002
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm6588
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.