DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and BI-1

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster


Alignment Length:153 Identity:36/153 - (23%)
Similarity:71/153 - (46%) Gaps:19/153 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TPLNFIFLFLFTVAESF--LLGMVAGQFEADEVLMAVGITAAVALGLTLFAL---QTKYDFTMCG 155
            |.|..::.|.|...::.  |||.:. ......:|.|:..|....:.|:|.||   |.||.:  .|
  Fly    86 TRLGMLYAFGFCSGQTLGPLLGYIC-SINPAIILSALTGTFVTFISLSLSALLAEQGKYLY--LG 147

  Fly   156 GVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLML----GGNHKYSISPEE 216
            |:||:.:....:..:..:......:.:....:|..:.:.::|||||.::    .||       .:
  Fly   148 GMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGN-------RD 205

  Fly   217 YIFAALNLYLDIINIFMYILTII 239
            .:..||:|:.|::::|..:|.|:
  Fly   206 VVQHALDLFFDVLSMFRRLLIIL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 36/153 (24%)
BI-1NP_648205.1 BI-1 21..233 CDD:198412 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.