DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and Tmbim1

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 / 316516 RGDID:1359409 Length:309 Species:Rattus norvegicus


Alignment Length:246 Identity:98/246 - (39%)
Similarity:155/246 - (63%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YHYQQGDETGAYTDAEADKSFA---FDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQE 63
            |.:...:|..|.:|     ||.   :||:.:|..||:|||.|:..|||||...::||||.:...|
  Rat    67 YGHDYSEEERAGSD-----SFGPGEWDDRKVRHTFIQKVYCIISVQLLITVAIIAVFTFVEPVSE 126

  Fly    64 WVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLM 128
            :|:.|.|:::::.||.|||.:.:.||:..||:.|.|.|.|.:||:|..|:.|.::..:|...|::
  Rat   127 YVRSNVAVYYVSYAVFIVTYLILVCCQGPRRRFPWNIILLTIFTLALGFMTGAISSMYETKAVII 191

  Fly   129 AVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFG----IIAIFIPGKVIGLVYASLGA 189
            |:.|||.|::.:|:|..|||.|||.|.|::....:|..:.|    ::..|.....:.:|||.|||
  Rat   192 AMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVTGAVTSVVLFFEYIYWLHMVYAGLGA 256

  Fly   190 LLFSVYLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIG 240
            :.|:::|.|||||:| ||.|::||||:||..||.:|.||:.||.::|.::|
  Rat   257 ICFTLFLAYDTQLVL-GNRKHTISPEDYITGALQIYTDIVYIFTFVLQLVG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 91/223 (41%)
Tmbim1NP_001007714.1 LFG_like 87..306 CDD:198410 91/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.