DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and Grina

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_695220.4 Gene:Grina / 266668 RGDID:628873 Length:348 Species:Rattus norvegicus


Alignment Length:218 Identity:107/218 - (49%)
Similarity:159/218 - (72%) Gaps:1/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACCE 90
            |:|||:.|||||:|:|..||.:|...|::|||....:.:|:.|...::::.|:..:::|.::||.
  Rat   131 DKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRANVWTYYVSYAIFFISLIVLSCCG 195

  Fly    91 SVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCG 155
            ..|||.|.|.:.|.:.|::.|:::||:|..:..:.|:||||||.||...:.:|::||:||||.|.
  Rat   196 DFRRKHPWNLVALSILTISLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCM 260

  Fly   156 GVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQLMLGGNHKYSISPEEYIFA 220
            |||:..:||..||.|:.|||..:::.:||||||||||:.:|..||||:| ||.:.|:|||||:||
  Rat   261 GVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLL-GNKQLSLSPEEYVFA 324

  Fly   221 ALNLYLDIINIFMYILTIIGLSR 243
            |||||.||||||:|||||||.::
  Rat   325 ALNLYTDIINIFLYILTIIGRAK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 105/213 (49%)
GrinaNP_695220.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
Pro-rich <16..126 CDD:291893
Bindin 24..>105 CDD:251078
LFG_like 131..344 CDD:198410 105/213 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2719
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41517
Inparanoid 1 1.050 264 1.000 Inparanoid score I2996
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8911
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.