DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and Faim2

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_653357.1 Gene:Faim2 / 246274 RGDID:628744 Length:316 Species:Rattus norvegicus


Alignment Length:244 Identity:107/244 - (43%)
Similarity:159/244 - (65%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKN 68
            |:.|...|.:   |...:|::|||.:|:.||||||.||:.|||:|...|::|||....:::||.|
  Rat    76 YEGGFPAGHH---ELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQAN 137

  Fly    69 PALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGIT 133
            |..:|.:.||...|.:.:|||...||..|.|.|.|.:||::.::|.||::..:....||:.:|||
  Rat   138 PGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGIT 202

  Fly   134 AAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFG-IIAIFIPGKVI---GLVYASLGALLFSV 194
            |.|.|.:|:|:.|||:|||.|.|||...|:.....| ::||.:|.:.:   ..|||.|||.:|::
  Rat   203 ALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTL 267

  Fly   195 YLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSR 243
            :|.:||||:: ||.::|:|||||||.|||:|||||.||.:.|.:.|.:|
  Rat   268 FLAFDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 100/220 (45%)
Faim2NP_653357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
LFG_like 92..312 CDD:198410 100/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 210 1.000 Domainoid score I2719
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8911
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.