DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and FAIM2

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_036438.2 Gene:FAIM2 / 23017 HGNCID:17067 Length:316 Species:Homo sapiens


Alignment Length:244 Identity:109/244 - (44%)
Similarity:159/244 - (65%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWVQKN 68
            |..|..||   |.|...:|::|||.:|:.|:||||.||:.|||:|...|::|||....:::||.|
Human    76 YDNGFPTG---DHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQAN 137

  Fly    69 PALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVLMAVGIT 133
            |..:|.:.||...|.:.:|||...||..|.|.|.|.:||::.::|.||::..:....||:.:|||
Human   138 PGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 202

  Fly   134 AAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFG-IIAIFIPGKVI---GLVYASLGALLFSV 194
            |.|.|.:|:|:.|||:|||.|.|||...|:.....| |:||.:|.:.:   ..|||:|||.:|::
Human   203 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTL 267

  Fly   195 YLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSR 243
            :|..||||:: ||.::|:|||||||.|||:|||||.||.:.|.:.|.:|
Human   268 FLALDTQLLM-GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 100/220 (45%)
FAIM2NP_036438.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
LFG_like 92..312 CDD:198410 100/220 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm8436
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.