DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and grina

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001120085.1 Gene:grina / 100145094 XenbaseID:XB-GENE-5740104 Length:286 Species:Xenopus tropicalis


Alignment Length:244 Identity:117/244 - (47%)
Similarity:158/244 - (64%) Gaps:11/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ETGAYT--DAEADK---------SFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQ 62
            |..:|.  ||||..         |..|.:.:||:.|||||||.|..||.:|.|.:.:|.|.|..:
 Frog    39 EANSYPEHDAEAGPPEYTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLICMFIFWKRLK 103

  Fly    63 EWVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVL 127
            .|||:.|.:.:.....:|:..:.:|||:.||||.|.|||||.|||..|..:||.:|..|:||.|:
 Frog   104 NWVQEYPYIVYALCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVM 168

  Fly   128 MAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLF 192
            .|.|.|..|.||||:||||||:||||..|.|...|:|.:.|||:...:....:.:||||:|..:|
 Frog   169 WAGGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMYLNIVYASIGTFIF 233

  Fly   193 SVYLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGL 241
            .:|||.||||::||.|:|::|||||||||||:||||||:|:.:|.|.|:
 Frog   234 GMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIFGI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 109/216 (50%)
grinaNP_001120085.1 DUF4526 <4..>55 CDD:291688 6/15 (40%)
LFG_like 64..281 CDD:198410 109/216 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2553
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3354
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - otm47433
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R158
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.