DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lfg and faim2b

DIOPT Version :9

Sequence 1:NP_725236.1 Gene:Lfg / 36418 FlyBaseID:FBgn0025692 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001373641.1 Gene:faim2b / 100006044 ZFINID:ZDB-GENE-120426-3 Length:263 Species:Danio rerio


Alignment Length:253 Identity:97/253 - (38%)
Similarity:162/253 - (64%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QGDETGAYTDAEA--------DKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQ 62
            :|.:..:|.:|.|        |..|.:||.|:|:.||||||.|||.||..|...:::|||....:
Zfish    14 EGSKPPSYEEANAGCPGYYYGDGGFTWDDASVRRIFIRKVYSILMLQLFSTVAVIALFTFHAPVR 78

  Fly    63 EWVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLFLFTVAESFLLGMVAGQFEADEVL 127
            .::|.:|.|:..:..:.::|.|.:|||..:||:.|.|.|.|.:||::.:.:||.::..:....|:
Zfish    79 MYIQTHPILYSASNLLFLITYISLACCGDLRRQFPWNLILLTVFTLSMACMLGFISSFYNTKAVV 143

  Fly   128 MAVGITAAVALGLTLFALQTKYDFTMCGGVL-VACLVVF---IIFGIIAIF--IPGKVIGLVYAS 186
            :.:||||.|.|.:|||:.|:|.|.|...|:| :.|:|:|   |:.|.:..|  :|.  :..||:|
Zfish   144 LCIGITAVVCLCVTLFSFQSKIDITSYQGLLFILCMVMFFCAIVMGFVVPFGYVPW--LHAVYSS 206

  Fly   187 LGALLFSVYLVYDTQLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSRN 244
            :||::|:::|.:||||:: ||.:|::|||||:||.|:|||||:.:|.::|.:.|..|:
Zfish   207 IGAVVFTMFLAFDTQLLM-GNKQYTLSPEEYVFATLSLYLDIVYLFTFLLQMFGQGRD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LfgNP_725236.1 LFG_like 23..240 CDD:198410 89/222 (40%)
faim2bNP_001373641.1 LFG_like 39..259 CDD:198410 89/222 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.