DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Balat and CG8925

DIOPT Version :10

Sequence 1:NP_610823.1 Gene:Balat / 36417 FlyBaseID:FBgn0033778 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_650526.1 Gene:CG8925 / 41963 FlyBaseID:FBgn0038404 Length:670 Species:Drosophila melanogaster


Alignment Length:192 Identity:39/192 - (20%)
Similarity:71/192 - (36%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RIIETPGNHSPHLLYGSP-------GMNGFAMMLKSGGNQYTSSPEPPSDGASGNVEHGATAGGS 199
            |..:..|...|.::.|||       ||..:.|:.:........|.|.|:          ||....
  Fly   665 REYDDSGKQPPRVVRGSPKGDIYCVGMIFYMMVEREDPYHLIHSVERPN----------ATLIKQ 719

  Fly   200 LVAIADKPARSPSDSGVSSILDEMLQPNLVLQRWKKDSGIPDCVQKELDKIVEISAYNKDLYTKA 264
            ::          :::.:..|.|:..|.|::|:..|      :|..:..||...|....:.:.|  
  Fly   720 IL----------NENHMPRITDDYRQENMLLEMCK------ECWDRNPDKRPTIKKLIESIST-- 766

  Fly   265 KLAKFPLEMGFNPNKSRIRKNCENEADNQDR---VKNNEASRRSRHKKKLMTHMLNTSLEFD 323
               .:||..| |.....||.: |..||..::   ::..:.:.......:|:..||..|:..|
  Fly   767 ---VYPLSKG-NLVDQMIRMS-EKYADELEQMVAIRTADLADAQMQTMRLLNEMLPASIAKD 823

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
BalatNP_610823.1 MFS_SLC22 128..524 CDD:340875 39/192 (20%)