DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Pi15

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:314 Identity:68/314 - (21%)
Similarity:107/314 - (34%) Gaps:115/314 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLLGQQLQAFDYCD--------PTLCPGPERHIACNNFGALADICSPDAHIVRITTARRT 65
            |::||.||         |:        ||     :..:..|||.......|.......|..|||.
Mouse    20 LVILLSLL---------CEAHTVVLLNPT-----DSSLPANNFTDTEAALSTPLESADIPKARRK 70

  Fly    66 MILNE-----LNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDH------- 118
            ..:::     :.:|.::: ||.:  |.||..|..:.||:.||..||.....|  :.||       
Mouse    71 RYISQNDMIAILDYHNQV-RGKV--FPPAANMEYMVWDENLAKSAEAWAATC--IWDHGPSYLLR 130

  Fly   119 ------CRNSEQFRNVAQVVAEGGWQGD------PLPPSSPSDPPNPEAPIPVEYHTEDEVIKAT 171
                  ...:.::|::.|:|..  |..:      |.|...     ||                  
Mouse   131 FLGQNLSVRTGRYRSILQLVKP--WYDEVKDYAFPYPQDC-----NP------------------ 170

  Fly   172 LEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAG 236
                     .|.||   .|.|           .| .::||:|..::..:||.|  .|....|..|
Mouse   171 ---------RCPMR---CFGP-----------MC-THYTQMVWATSNRIGCAI--HTCQNMNVWG 209

  Fly   237 QSLSSVHQ---YMTCNFV-RTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVN 286
                ||.:   |:.||:. :.|.:....|:.| .|.:.|    .|.:...|:.|
Mouse   210 ----SVWRRAVYLVCNYAPKGNWIGEAPYKVG-VPCSSC----PPSYGGACTDN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/212 (21%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 44/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.