DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and PRY2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:35/163 - (21%)
Similarity:57/163 - (34%) Gaps:57/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIP 158
            :|.|...||::|:             ..::.:.....:|..||..|:.|               .
Yeast   212 SLTWSDTLATYAQ-------------NYADSYDCSGNLVHSGGPYGENL---------------A 248

  Fly   159 VEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCG 223
            :.|.|...|        .|.|.|.:..|   :|.|.       .|:...:|||:|...|:.||||
Yeast   249 LGYGTTGSV--------DAWYNEITSYD---YSNPG-------FSESAGHFTQVVWKGTSEVGCG 295

  Fly   224 ILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDV 256
            :    |:...|.|       .|:.|::....:|
Yeast   296 L----KSCGGEWG-------DYIICSYKAAGNV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 34/155 (22%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.