DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and PRY1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:35/130 - (26%)
Similarity:45/130 - (34%) Gaps:46/130 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPV 159
            |.|...|||:|:          |:..|   :.....:...||..|:.|....       :.|..|
Yeast   183 LSWSDTLASYAQ----------DYADN---YDCSGTLTHSGGPYGENLALGY-------DGPAAV 227

  Fly   160 EYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGI 224
            :                |.|.|.|..|   ||.|.       .|....:|||:|..|||.|||||
Yeast   228 D----------------AWYNEISNYD---FSNPG-------FSSNTGHFTQVVWKSTTQVGCGI 266

  Fly   225  224
            Yeast   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 35/130 (27%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.