powered by:
Protein Alignment CG17575 and NR0B2
DIOPT Version :9
Sequence 1: | NP_001188917.1 |
Gene: | CG17575 / 36414 |
FlyBaseID: | FBgn0250842 |
Length: | 298 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_068804.1 |
Gene: | NR0B2 / 8431 |
HGNCID: | 7961 |
Length: | 257 |
Species: | Homo sapiens |
Alignment Length: | 59 |
Identity: | 16/59 - (27%) |
Similarity: | 23/59 - (38%) |
Gaps: | 9/59 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 PATRMATLQWDQ-ELASF--AELNVKRCA------LVNDHCRNSEQFRNVAQVVAEGGW 137
|...:|.:||.| .|.|| .||:.|..| |.|......:...::..:..|..|
Human 139 PQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHW 197
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S204 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.