DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and AT1G01310

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:219 Identity:42/219 - (19%)
Similarity:63/219 - (28%) Gaps:89/219 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAEL----NVKRCALVNDH 118
            |:..|.|..::.. |..|.|:      |..|      .|||..||::|..    .|..|.||:. 
plant    80 RVNRASREFLIAH-NLVRARV------GEPP------FQWDGRLAAYARTWANQRVGDCRLVHS- 130

  Fly   119 CRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECS 183
              |.....|:.       |.|.                                       ...|
plant   131 --NGPYGENIF-------WAGK---------------------------------------NNWS 147

  Fly   184 MRDIIAFSPPNNRILRLRVSKC-----IAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVH 243
            .|||:......::...::.:.|     ..::||:|...:|.|||            |....|:..
plant   148 PRDIVNVWADEDKFYDVKGNTCEPQHMCGHYTQIVWRDSTKVGC------------ASVDCSNGG 200

  Fly   244 QYMTCNFVRTNDVNAPVYQSGDRP 267
            .|..|.:      |.|....|:.|
plant   201 VYAICVY------NPPGNYEGENP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 36/194 (19%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 39/212 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.