DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crispld1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:256 Identity:56/256 - (21%)
Similarity:85/256 - (33%) Gaps:96/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSE 123
            ||......||:..|:.|.::       :..|:.|..:.||.||...||...:.|.          
Mouse    57 ITDNDMQSILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCL---------- 104

  Fly   124 QFRNVAQVVAEGGWQGDP--LPPSSPSD---------PPNPEAPIPVEYHTEDEVIKATLEQMFA 177
                         |:..|  |.||...:         ||.        :|.:            |
Mouse   105 -------------WEHGPASLLPSIGQNLGAHWGRYRPPT--------FHVQ------------A 136

  Fly   178 EYKECSMRDIIAFSPPNNRILRLRVSKCIAY------------FTQLVRDSTTHVGCGILRQTKN 230
            .|.|  :||   ||.|..       ::|..|            :||:|..:::.:||.:  ...:
Mouse   137 WYDE--VRD---FSYPYE-------NECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAV--NLCH 187

  Fly   231 TTNEAGQSLSSVHQYMTCNFVRTND--VNAPVYQSGDRPATECRSGRNPVFINLCSVNEIY 289
            ..|..||..... .|:.||:....:  .:|| |:.| ||.:.|    .|.|...|..|..|
Mouse   188 NMNIWGQIWPKA-VYLVCNYSPKGNWWGHAP-YKHG-RPCSAC----PPSFGGGCRENLCY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 41/208 (20%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 42/209 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.