powered by:
Protein Alignment CG17575 and AT5G57625
DIOPT Version :9
Sequence 1: | NP_001188917.1 |
Gene: | CG17575 / 36414 |
FlyBaseID: | FBgn0250842 |
Length: | 298 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_680450.1 |
Gene: | AT5G57625 / 835867 |
AraportID: | AT5G57625 |
Length: | 207 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 14/60 - (23%) |
Similarity: | 25/60 - (41%) |
Gaps: | 17/60 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 YFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRP 267
::||:|...|..:||. ....|.|..: ::|||: :.|....|::|
plant 164 HYTQMVWRDTKRLGCA------RVVCENGAGV-----FITCNY------DPPGNYVGEKP 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.