DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and AT5G26130

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_197985.2 Gene:AT5G26130 / 832682 AraportID:AT5G26130 Length:166 Species:Arabidopsis thaliana


Alignment Length:187 Identity:33/187 - (17%)
Similarity:65/187 - (34%) Gaps:71/187 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNELNEYRDRIARGDLMGFSPATRMATLQW----DQELASFAELNVKRCALVNDHCRNSEQFRNV 128
            |:|.|..|.::      |..|      ::|    :|...::|:.....|:|.:.: .|.....|:
plant    35 LDEHNRARTQV------GVPP------MKWHAGAEQYAWNYAQQRKGDCSLTHSN-SNGLYGENL 86

  Fly   129 AQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPP 193
            |       |.|..|        ...|| :.:..:.:.:.|.|:  ...::.|:|           
plant    87 A-------WSGGAL--------SGAEA-VKLWVNEKSDYIYAS--NTCSDGKQC----------- 122

  Fly   194 NNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF 250
                         .::||:|..::..|||..::.....|            ::|||:
plant   123 -------------GHYTQVVWRTSEWVGCAKVKCDNGGT------------FVTCNY 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 32/185 (17%)
AT5G26130NP_197985.2 CAP_PR-1 31..166 CDD:349400 33/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.