DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and AT4G33730

DIOPT Version :10

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:43 Identity:12/43 - (27%)
Similarity:20/43 - (46%) Gaps:12/43 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 YFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF 250
            ::||:|...:..:|||     |...|. |.|:      :.||:
plant   130 HYTQVVWRGSARLGCG-----KAKCNN-GASI------VVCNY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 CAP_euk 64..250 CDD:349399 11/41 (27%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 12/43 (28%)

Return to query results.
Submit another query.