DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and AT3G19690

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:232 Identity:49/232 - (21%)
Similarity:78/232 - (33%) Gaps:96/232 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FGALADICSP---DAHIVRITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQEL--- 101
            :|:||:....   :||                ||.|:.:      |..|      |.||.|:   
plant    18 YGSLAEDLQQQFLEAH----------------NEARNEV------GLDP------LVWDDEVAAY 54

  Fly   102 -ASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTED 165
             ||:|...:..||||:.:                 |..|:.:..||.            |...||
plant    55 AASYANQRINDCALVHSN-----------------GPFGENIAMSSG------------EMSAED 90

  Fly   166 EVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKN 230
            .......|:.:.:|...:..|      ||.       ..|: ::||:|..:|..:||     .|.
plant    91 AAEMWINEKQYYDYDSNTCND------PNG-------GTCL-HYTQVVWKNTVRLGC-----AKV 136

  Fly   231 TTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRP 267
            ..|..|       .::|||:      :.|....|::|
plant   137 VCNSGG-------TFITCNY------DPPGNYIGEKP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 40/189 (21%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 46/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.