DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and AT2G19970

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:185 Identity:38/185 - (20%)
Similarity:64/185 - (34%) Gaps:62/185 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ATRMATLQWDQELASFAE--LNVKRCALVNDH--CRNSE--QFRNVAQVVAEGGWQGDPLPPSSP 147
            |..:|.|:|::.:|::|:  .|.:..|.|.|:  .|:|:  ...|:|     .||       ..|
plant    48 AVGVAPLKWNKTVAAYAQKFANRQAKAGVCDYSSMRHSDGPYGENIA-----AGW-------VQP 100

  Fly   148 SDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQL 212
            .|  ....||..:|...::                          ||......:......::||:
plant   101 KD--QMSGPIAAKYWLTEK--------------------------PNYDHATNKCKDVCGHYTQM 137

  Fly   213 VRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRP 267
            |.:.:..:|||..|..:|..           .|:.||:     ...||.....||
plant   138 VANQSLSLGCGSFRCHENEL-----------IYIVCNY-----YPMPVGDENTRP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/166 (20%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 38/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.