DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and PRB1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:187 Identity:34/187 - (18%)
Similarity:60/187 - (32%) Gaps:75/187 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRN-SEQFRNVAQV 131
            :|..|:.|.:|      |..|      :|||:.||::|              || :.|.:...::
plant    34 VNAHNQARSQI------GVGP------MQWDEGLAAYA--------------RNYANQLKGDCRL 72

  Fly   132 VAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNR 196
            |...|..|:.|..|.                  .::.......::...|.....|          
plant    73 VHSRGPYGENLAKSG------------------GDLSGVAAVNLWVNEKANYNYD---------- 109

  Fly   197 ILRLRVSKC---IAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF 250
                 .:.|   ..::||:|..::..:||..:|     .|..|..:|       ||:
plant   110 -----TNTCNGVCGHYTQVVWRNSVRLGCAKVR-----CNNGGTIIS-------CNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 33/185 (18%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 34/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.