DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crispld2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:287 Identity:69/287 - (24%)
Similarity:114/287 - (39%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNE 73
            :|:.|.||...:|||      ..|         |..:|..:.|...|....:..||.:.:::..|
Mouse     9 VLMGLALLVCGVQAF------FLP---------NTTSLEKLLSKYQHAEPHSRVRRAIPMSDRQE 58

  Fly    74 ---YRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAE- 134
               ..::: ||.:  :.||:.|..:.||:||...|.....||  :.:| ..:...|::.|.:|. 
Mouse    59 ILMLHNKL-RGQV--YPPASNMEHMTWDEELERSAAAWAHRC--LWEH-GPAGLLRSIGQNLAVH 117

  Fly   135 -GGWQGDPLPPSSPSDPPNPEAPIPVEYHTE---DEVIKATLEQMFAEYKECSMRDIIAFSPPNN 195
             |.::       ||.            :|.:   |||...|    :....||:.|          
Mouse   118 WGRYR-------SPG------------FHVQSWYDEVKDYT----YPYPHECTPR---------- 149

  Fly   196 RILRLRVS--KCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF-VRTNDVN 257
              .|.|.|  .| .::||:|..:|..:||.:  .|....|..|.:..:. .|:.||: .:.|.:.
Mouse   150 --CRERCSGPMC-THYTQMVWATTNKIGCAV--HTCRNMNVWGDTWENA-VYLVCNYSPKGNWIG 208

  Fly   258 APVYQSGDRPATECRSGRNPVFI-NLC 283
            ...|:.| ||.:||.|......: |||
Mouse   209 EAPYKHG-RPCSECPSSYGGGCLNNLC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 44/195 (23%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 44/189 (23%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.