DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Crisp4

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:260 Identity:49/260 - (18%)
Similarity:79/260 - (30%) Gaps:96/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IVRITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCR 120
            |....|..:..|:|..|.:|.:::       .||..|..:.|....|..|.:..:.|        
Mouse    77 ITESQTEPQEEIVNTHNAFRRKVS-------PPARNMLKVSWSSAAAENARILARYC-------- 126

  Fly   121 NSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMR 185
                                     ..||..:.|..:|..:..|:         |..|:...|..
Mouse   127 -------------------------DKSDSDSLERRLPNTFCGEN---------MLMEHYPSSWS 157

  Fly   186 DIIAFSPPNNRILRLRVSKCIAY--------------FTQLVRDSTTHVGCGI--LRQTKNTTNE 234
            .:|.        :....||...|              :||:|..||..|||.:  .|:.|..|  
Mouse   158 KVIE--------IWFNESKYFKYGEWPSTDDDIETDHYTQMVWASTYLVGCDVAACRRQKAAT-- 212

  Fly   235 AGQSLSSVHQYM-TCNFVRTND----VNAPVYQSGDRPATECRSG-RNPVFINLCSVNEIYDSSN 293
                      |: .|::....:    :|.| |:.|. |..:|.:. .:.:..|.|.   .||..|
Mouse   213 ----------YLYVCHYCHEGNHQDTLNMP-YKEGS-PCDDCPNNCEDGLCTNPCI---YYDEYN 262

  Fly   294  293
            Mouse   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 36/202 (18%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.