DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Pi16

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:294 Identity:71/294 - (24%)
Similarity:107/294 - (36%) Gaps:124/294 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTA-----RRTM 66
            |||||||:|              :..||                         |||     ::||
Mouse    13 PPLLLLLLL--------------IATGP-------------------------TTALTEDEKQTM 38

  Fly    67 ILNEL-NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFR---N 127
            :  :| |:||.:::       .||:.|..::||.|||:||:...::|  |..|  |.|:.|   |
Mouse    39 V--DLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKC--VWGH--NKERGRRGEN 90

  Fly   128 VAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPV-EYHTEDEVIKATLEQMFAEYKECSMRDIIAFS 191
            :..:..||                 .:.|:.| .:|.|.            ||...|    .|..
Mouse    91 LFAITDEG-----------------MDVPLAVGNWHEEH------------EYYNFS----TATC 122

  Fly   192 PPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGI-LRQTKNTTNEAGQSLSSVHQYMTCNFVRTND 255
            .||         :...::||:|...|..:|||. ..:|.....||     ::| .:.||:....:
Mouse   123 DPN---------QMCGHYTQVVWSKTERIGCGSHFCETLQGVEEA-----NIH-LLVCNYEPPGN 172

  Fly   256 VNA-PVYQSGDRPATECRSG-----------RNP 277
            |.. ..||.| .|.::|..|           |||
Mouse   173 VKGRKPYQEG-TPCSQCPLGYSCENSLCEPMRNP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 47/191 (25%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 48/193 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.