DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Glipr1

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:159 Identity:30/159 - (18%)
Similarity:53/159 - (33%) Gaps:55/159 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVND---HCRNSEQFRNVAQVVA 133
            |:.|.:::       .||..|..:.||.:||..|:...|.|...::   |.|....|    ..:.
Mouse    42 NQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNF----TALG 95

  Fly   134 EGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRIL 198
            |..|.|.                  :...:....|.|..|::  ::.:.|.|             
Mouse    96 ENIWLGS------------------LSIFSVSSAISAWYEEI--KHYDFSTR------------- 127

  Fly   199 RLRVSKC---IAYFTQLVRDSTTHVGCGI 224
                 ||   ..::||:|...:..:||.:
Mouse   128 -----KCRHVCGHYTQVVWADSYKLGCAV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 30/159 (19%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 30/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.