DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and CRISP2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:334 Identity:68/334 - (20%)
Similarity:109/334 - (32%) Gaps:126/334 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTM--ILNE 70
            |:|.|:.:|...|.| :..||.             |.||            :||..:..  |:|:
Human     5 PVLFLVTVLLPSLPA-EGKDPA-------------FTAL------------LTTQLQVQREIVNK 43

  Fly    71 LNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEG 135
            .||.|..::       .||:.|..::|.:|:.:.|:....:|.|.:    :..:.|..:....|.
Human    44 HNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQH----SDPEDRKTSTRCGEN 97

  Fly   136 GWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRL 200
            .:..        |||.:..:.|...|   ||::                 |.:....|.:     
Human    98 LYMS--------SDPTSWSSAIQSWY---DEIL-----------------DFVYGVGPKS----- 129

  Fly   201 RVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRT------------ 253
             .:..:.::||||..||..|||||    ....|:.......|.||  |..::|            
Human   130 -PNAVVGHYTQLVWYSTYQVGCGI----AYCPNQDSLKYYYVCQY--CPAMKTYLNKREGINVWK 187

  Fly   254 ------------------------NDVNAPVYQSGDRPA---TECRSGRNPVFINLCSVNEIYDS 291
                                    |..|.| ||.|...|   .:|..|   :..|.|...::..:
Human   188 CFLRLRHFQLLRGEQLLTFSGNNMNRKNTP-YQQGTPCAGCPDDCDKG---LCTNSCQYQDLLSN 248

  Fly   292 ----SNLAG 296
                .|.||
Human   249 CDSLKNTAG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 40/187 (21%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 40/187 (21%)
Crisp 224..278 CDD:285731 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.