DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17575 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:233 Identity:50/233 - (21%)
Similarity:78/233 - (33%) Gaps:64/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LNEYRDRIARGDLMG--FSPATRMATLQWDQELASFAELNVKRCALV-NDHCRNSEQFRNVAQVV 132
            :|||..  ...:|.|  |.|...:..:.||..|:..|....|:|... |.|.....:...|...:
Mouse    51 INEYVG--LHNELRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEI 113

  Fly   133 AEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQ--MFAEYKECSMRDIIAFSPPNN 195
            .|..|.|                  |||..|....|::..|:  .::...:..:.|         
Mouse   114 GENMWVG------------------PVEDFTVTTAIRSWHEERKSYSYLNDTCVED--------- 151

  Fly   196 RILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYM-TCNFVRTNDVNAP 259
                   ..| :::.|||.||:..|||.:     .:...||   ...|..: .||:.....:...
Mouse   152 -------QNC-SHYIQLVWDSSYKVGCAV-----TSCARAG---GFTHAALFICNYAPGGTLTRR 200

  Fly   260 VYQSGD-----RPATECRSGRNPVFINLCSVNEIYDSS 292
            .||:|.     .|..:|..       .||| |.:.|.:
Mouse   201 PYQAGQFCSRCGPGDQCTD-------YLCS-NTVRDEA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 39/184 (21%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 40/187 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.